
Therapeutic Area | MeSH |
|---|---|
| nervous system diseases | D009422 |
| immune system diseases | D007154 |
Brand Name | Status | Last Update |
|---|---|---|
| avonex | Biologic Licensing Application | 2016-03-31 |
| avonex avonex avonex pen | Biologic Licensing Application | 2020-12-16 |
| avonex avonex pen | Biologic Licensing Application | 2025-11-19 |
| betaseron | Biologic Licensing Application | 2026-03-03 |
| rebif | Biologic Licensing Application | 2010-01-14 |
| rebif rebif rebidose | Biologic Licensing Application | 2025-09-22 |
Code | Description |
|---|---|
| J1826 | Injection, interferon beta-1a, 30 mcg |
| J1830 | Injection, interferon beta-1b, 0.25 mg (code may be used for medicare when drug administered under the direct supervision of a physician, not for use when drug is self administered) |
| Q3027 | Injection, interferon beta-1a, 1 mcg for intramuscular use |
| Q3028 | Injection, interferon beta-1a, 1 mcg for subcutaneous use |

Indication | MeSH | Ontology | ICD-10 | Ph 1 | Ph 2 | Ph 3 | Ph 4 | Other | Total |
|---|---|---|---|---|---|---|---|---|---|
| Multiple sclerosis | D009103 | EFO_0003885 | G35 | — | — | 1 | — | — | 1 |
| Relapsing-remitting multiple sclerosis | D020529 | EFO_0003929 | — | — | — | 1 | — | — | 1 |
| Sclerosis | D012598 | — | — | — | — | 1 | — | — | 1 |
| Drug common name | Interferon beta |
| INN | interferon beta |
| Description | The type-I interferons (IFN) are cytokines which play essential roles in inflammation, immunoregulation, tumor cells recognition, and T-cell responses. In the human genome, a cluster of thirteen functional IFN genes is located at the 9p21.3 cytoband over approximately 400 kb including coding genes for IFNα (IFNA1, IFNA2, IFNA4, IFNA5, IFNA6, IFNA7, IFNA8, IFNA10, IFNA13, IFNA14, IFNA16, IFNA17 and IFNA21), IFNω (IFNW1), IFNɛ (IFNE), IFNк (IFNK) and IFNβ (IFNB1), plus 11 IFN pseudogenes.
|
| Classification | Protein |
| Drug class | — |
| Image (chem structure or protein) | ![]() |
| Structure (InChI/SMILES or Protein Sequence) | >4CNI:A,H|OLOKIZUMAB HEAVY CHAIN, FAB PORTION
EVQLVESGGGLVQPGGSLRLSCAASGFNFNDYFMNWVRQAPGKGLEWVAQMRNKNYQYGTYYAESLEGRFTISRDDSKNS
LYLQMNSLKTEDTAVYYCARESYYGFTSYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES
>4CNI:B,L|OLOKIZUMAB LIGHT CHAIN, FAB PORTION
DIQMTQSPSSLSASVGDRVTITCQASQDIGISLSWYQQKPGKAPKLLIYNANNLADGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCLQHNSAPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |



